DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and OTUD4

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_011530342.2 Gene:OTUD4 / 54726 HGNCID:24949 Length:1121 Species:Homo sapiens


Alignment Length:153 Identity:31/153 - (20%)
Similarity:65/153 - (42%) Gaps:33/153 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 RQLSLHN--IPSDGDCLYQSIRHQLIVNALPGHSVQ---ELREETANYVRAHKDSL------ISY 223
            |:|.|:.  :..||.||::::..|::      ||..   |:|....:|:|.:::..      ..:
Human    30 RKLGLYRKLVAKDGSCLFRAVAEQVL------HSQSRHVEVRMACIHYLRENREKFEAVTCNFKH 88

  Fly   224 MIHPETGDILNDQQFEQYCHDIAKTHAWGGHIELKAISSLLRVPIEVIQAEG-APTLLGQEEFGG 287
            .|         :..||:|...:.....|.|.:|:.|:|.:.|....:.:... :|:.:.:..| .
Human    89 FI---------EGSFEEYLKRLENPQEWVGQVEISALSLMYRKDFIIYREPNVSPSQVTENNF-P 143

  Fly   288 SPLIICYHRHIYQLGAHYNSTVP 310
            ..:::|:..     |.||:...|
Human   144 EKVLLCFSN-----GNHYDIVYP 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 30/148 (20%)
OTU 178..305 CDD:280496 25/136 (18%)
OTUD4XP_011530342.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145153
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.