DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and OTUD6B

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_057107.4 Gene:OTUD6B / 51633 HGNCID:24281 Length:293 Species:Homo sapiens


Alignment Length:316 Identity:125/316 - (39%)
Similarity:184/316 - (58%) Gaps:55/316 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AELESRLDEVSLEDIGARHRRERKDLQAKLQAMKKNAPKNNKNKRKEFLEEMARLEGELEQRHKA 73
            |.|...|||.  |.:..|||:|:|:||||:|.||...|||:|.:||:..|::|:||.|:||:|:.
Human     3 AVLTEELDEE--EQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHRE 65

  Fly    74 ELKAAEAMEAPVLVEPVVKEPAEKPETEVTDDDGIEEKEEQLAPN----------QRVSKAQKRR 128
            ||:                      :.::|..   |.|.:.:|.|          .|:|||||||
Human    66 ELE----------------------QLKLTTK---ENKIDSVAVNISNLVLENQPPRISKAQKRR 105

  Fly   129 DKKA-----KEARAREAEIKTELQNAANQPTPKLIELQQITAKLSQRQLSLHNIPSDGDCLYQSI 188
            :|||     :|.|..||||: .|..|.:..:.||.::      |:.|||.:..|||||.|:|::|
Human   106 EKKAALEKEREERIAEAEIE-NLTGARHMESEKLAQI------LAARQLEIKQIPSDGHCMYKAI 163

  Fly   189 RHQLIVN--ALPGHSVQELREETANYVRAHKDSLISYMIHPETGDILNDQQFEQYCHDIAKTHAW 251
            ..||...  ||   :|..||.:||.|:::|.:..:.::.:|.|||:...::|::||.||..|.||
Human   164 EDQLKEKDCAL---TVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTAAW 225

  Fly   252 GGHIELKAISSLLRVPIEVIQAEGAPTLLGQEEFGGSPLIICYHRHIYQLGAHYNS 307
            ||.:||:|:|.:|:.|||:|||:..|.::| ||:...|||:.|.||.|.||.||||
Human   226 GGQLELRALSHILQTPIEIIQADSPPIIVG-EEYSKKPLILVYMRHAYGLGEHYNS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 119/306 (39%)
OTU 178..305 CDD:280496 56/128 (44%)
OTUD6BNP_057107.4 COG5539 18..280 CDD:227826 117/297 (39%)
Cys-loop. /evidence=ECO:0000250 152..158 5/5 (100%)
OTU 153..278 CDD:280496 56/128 (44%)
Variable-loop. /evidence=ECO:0000250 219..229 6/9 (67%)
His-loop. /evidence=ECO:0000250 267..277 6/9 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5593
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6064
Inparanoid 1 1.050 209 1.000 Inparanoid score I3684
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54513
OrthoDB 1 1.010 - - D1541668at2759
OrthoFinder 1 1.000 - - FOG0003029
OrthoInspector 1 1.000 - - otm42000
orthoMCL 1 0.900 - - OOG6_102788
Panther 1 1.100 - - LDO PTHR12419
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3778
SonicParanoid 1 1.000 - - X2018
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1313.010

Return to query results.
Submit another query.