DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and Otud1

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_574086.3 Gene:Otud1 / 498803 RGDID:1563344 Length:455 Species:Rattus norvegicus


Alignment Length:254 Identity:64/254 - (25%)
Similarity:105/254 - (41%) Gaps:66/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 HKAELKAAE-AMEAPVLVEPVVKEPAEKPETEVTDDDGIEEKEEQLAPNQRVSKAQKRRDKKAKE 134
            |:..|.||: ...||.   ||..||...|.:        ||:..:.:| :...:|..|.|....:
  Rat   163 HRQALAAAQHRAPAPA---PVGPEPGAGPWS--------EERRTERSP-RGWDRASGRSDASGAD 215

  Fly   135 ARAR-EAEIKTE----------------LQN------AANQPTPK-------LIELQQITAKLSQ 169
            |..| :.||:..                .||      .|.:..|:       |.|:::....|.|
  Rat   216 AHRRPDPEIEVHPVPAPAPAPARSSGDPTQNGEGEAVGAPRADPRDEKLALYLAEVERQDKYLRQ 280

  Fly   170 R-QLSLHNIPSDGDCLYQSIRHQLIVNALPGHSVQELREETANYVRAHKDSLISYMIHPETGDIL 233
            | :...|.|| ||:|||::: .:.:......|  :||||:|.:|:..|.|. .|.:|..:.|   
  Rat   281 RNKYRFHIIP-DGNCLYRAV-SKTVYGDQSLH--RELREQTVHYIADHLDH-FSPLIEGDVG--- 337

  Fly   234 NDQQFEQYCHDIAKTHAWGGHIELKAISSLLRVPIEV-----IQAEGAPTL---LGQEE 284
                  ::....|:..||.|:.||.|:..:|.|.|.:     :::....|:   ||.|:
  Rat   338 ------EFIIAAAQDGAWAGYPELLAMGQMLNVNIHLTTGGRLESPTVSTMVHYLGPED 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 64/254 (25%)
OTU 178..305 CDD:280496 32/115 (28%)
Otud1XP_574086.3 OTU 289..406 CDD:280496 33/116 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.