DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and otud5

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001004849.1 Gene:otud5 / 448134 XenbaseID:XB-GENE-6455884 Length:518 Species:Xenopus tropicalis


Alignment Length:218 Identity:47/218 - (21%)
Similarity:84/218 - (38%) Gaps:49/218 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 PAEKPETEVTDDDGIEEKEEQLAPNQRVSKAQKRRDKKAKEARAREAEIKTELQNAANQPTPKLI 158
            |...|:.|....:..|::.|..|..|.:.         ...|..:|...:..||           
 Frog   122 PGSSPDREDGAGNNSEDEYETAARTQAID---------PDTAEQQEHWFEKALQ----------- 166

  Fly   159 ELQQITAKLSQRQLSLHNIPSDGDCLYQSIRHQLIVNALPGHSVQELREETANYVRAHKDSLISY 223
                     .::...:..:..||.||::::..| :......|.|  :|:...:|:..:.|...:|
 Frog   167 ---------EKKGFIIKQMKEDGACLFRAVADQ-VYGDQDMHEV--VRKHCMDYLMKNADYFSNY 219

  Fly   224 MIHPETGDILNDQQFEQYCHDIAKTHAWGGHIELKAISSLLRVPIEVIQ--AEGAPTLLGQEEFG 286
            :          .:.|..|.:...|.:..|.|||::|::.:...|:||.|  .|...|..|.::..
 Frog   220 V----------TEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYGTEPINTFHGIQQNE 274

  Fly   287 GSPLIICYHRHIYQLGAHYNSTV 309
            ..|:.:.|||:|     ||||.|
 Frog   275 DEPIRVSYHRNI-----HYNSVV 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 44/214 (21%)
OTU 178..305 CDD:280496 31/128 (24%)
otud5NP_001004849.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..79
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 105..144 5/21 (24%)
Cys-loop. /evidence=ECO:0000250 176..182 2/5 (40%)
OTU 179..288 CDD:303090 31/126 (25%)
Variable-loop. /evidence=ECO:0000250 231..241 2/9 (22%)
His-loop. /evidence=ECO:0000250 282..287 4/9 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 371..450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.