DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and Duba

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_648482.3 Gene:Duba / 39302 FlyBaseID:FBgn0036180 Length:659 Species:Drosophila melanogaster


Alignment Length:311 Identity:74/311 - (23%)
Similarity:120/311 - (38%) Gaps:51/311 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IGARHRRERKDLQAKLQAMKKNAP-KNNKNKRKEFLEEMARL--EGELEQRHKAELKAAEAMEAP 84
            |..:..:.|.::..:|....:.:| |:.::||:|..|..|.|  ...||:.......||....||
  Fly    51 IDGQSPQRRGEVYDELARTHRCSPHKSTRSKRREHHEAHAHLYKRDRLEREKLVHPTAAAGSGAP 115

  Fly    85 VLVEPVVKEPAEKPETEVTDDD-----GIEEKEEQLAPNQRVSKAQKRRDKKAKEARAREAEIKT 144
            .:.......|   |.|..:...     |....|........|..||.:.......|..    :||
  Fly   116 GVSGSKCNSP---PSTSTSGSSSPSAVGRNSPEHLGLGCTTVPTAQVQMSTSTAAANL----LKT 173

  Fly   145 ELQNAA--------NQPTPKLIELQQITAK-------LSQRQLSLHNIPSDGDCLYQSIRHQLIV 194
            ..:..:        :||..:||.:::...:       :.||...|..:..||.||::||..| |.
  Fly   174 VEETFSGYNSGDEHHQPKERLIPVEEWQRRDLEFAKCMEQRGYELKPVEEDGACLFRSISLQ-IY 237

  Fly   195 NALPGHSVQELREETANYVRAHKDSLISYMIHPETGDILNDQQFEQYCHDIAKTHAWGGHIELKA 259
            .....|.|  :|:.|.:|:..:::....::    |.||      ..|........|.|.|||::|
  Fly   238 GDEEMHDV--IRQHTMDYIHENREYFGQFV----TEDI------NSYIQRKRARDAHGNHIEIQA 290

  Fly   260 ISSLLRVPIEVIQAEGAPTLL---GQEEFGGSPLIICYHRHIYQLGAHYNS 307
            ||.:....:||...:..|..:   .|.:.|..||     |..||.|:|||:
  Fly   291 ISEIYSRTVEVYCYQSNPINIFNSEQSQAGYPPL-----RLSYQRGSHYNA 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 73/309 (24%)
OTU 178..305 CDD:280496 36/129 (28%)
DubaNP_648482.3 OTU 224..334 CDD:303090 36/127 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445862
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12419
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.