DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and CG4603

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001261435.1 Gene:CG4603 / 38603 FlyBaseID:FBgn0035593 Length:371 Species:Drosophila melanogaster


Alignment Length:292 Identity:70/292 - (23%)
Similarity:113/292 - (38%) Gaps:51/292 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KNKRKEF----LEEMARLEGELEQRHKAELKAA---EAMEAPVLV--EPVVKEPAEKPETEVTDD 105
            |:|:.:|    |.|...| |||    |.::..|   ||.:..|||  .|...:.:::.|......
  Fly    10 KSKKGQFIVNDLNEHTTL-GEL----KTKIVQATDIEATQLHVLVGYPPKPLDLSQQQEQRALKA 69

  Fly   106 DGIE-------EKEEQLAPNQRVSKAQKRRDKKAKEARAREAEIKTELQNAANQPTPKLIELQQI 163
            .||.       |::...||...|.......|.:|...|.:..|....||..|..|..:..:.|..
  Fly    70 VGINSGETLIVEEKAAPAPAAPVPGGTTVEDDEALARRLQAEEEAQLLQETAGGPVAQAADYQLP 134

  Fly   164 TAKLSQRQLSLHN-------IPSDGDCLYQSIRHQLIVNA-LPGHSVQELREETANYVRAHKDSL 220
            .|..........|       :|:|..||:.|||  .::|. :.....:.:|...|..|.|...|.
  Fly   135 VAPTESGPNGDFNGILLKKVVPADNSCLFTSIR--FVLNGKVDNEGSEMMRHIIAQEVAADPQSY 197

  Fly   221 ISYMIHPETGDILNDQQFEQYCHDIAKTHAWGGHIELKAISSLLRVPIEVIQAEGA-PTLLGQEE 284
                     .|.:..:...:||..|.|..:|||.||:..:|:...:.|:|:..:.| ....|:::
  Fly   198 ---------NDAVLGKSNAEYCAWIQKADSWGGAIEVSILSNYYGIEIDVVDIQNAIINRFGEDK 253

  Fly   285 FGGSPLIICYHRHIYQLGAHYN----STVPAA 312
            ..|..:.:.:.      |.||:    .|.|:|
  Fly   254 NFGLRVFLLFD------GIHYDPLYMETSPSA 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 67/285 (24%)
OTU 178..305 CDD:280496 30/128 (23%)
CG4603NP_001261435.1 UBQ 5..80 CDD:214563 20/74 (27%)
UBQ 10..80 CDD:294102 20/74 (27%)
COG5539 <158..346 CDD:227826 34/139 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5539
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.