DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and Yod1

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001008889.1 Gene:Yod1 / 363982 RGDID:1359726 Length:303 Species:Rattus norvegicus


Alignment Length:130 Identity:34/130 - (26%)
Similarity:55/130 - (42%) Gaps:14/130 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 IPSDGDCLYQSIRHQLIVNALPGHSVQELREETANYVRAHKDSLISYMIHPETGDILNDQQFEQY 241
            :|:|..||:.|:.:.:....|......|:|...|..|.:..| |.|..|..:|.        |:|
  Rat   109 VPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPD-LYSEAILGKTN--------EEY 164

  Fly   242 CHDIAKTHAWGGHIELKAISSLLRVPIEVIQAEGAPTLLGQEEFGGSPLIICYHRHIYQLGAHYN 306
            |..|.:...|||.||:..:|...:..|.|:..:........|:.|.:..::.    ||. |.||:
  Rat   165 CDWIRRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLL----IYD-GIHYD 224

  Fly   307  306
              Rat   225  224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 34/130 (26%)
OTU 178..305 CDD:280496 32/126 (25%)
Yod1NP_001008889.1 UBQ <23..70 CDD:294102
COG5539 32..302 CDD:227826 34/130 (26%)
OTU 110..225 CDD:303090 34/129 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.