DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and Otud5

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_006256799.1 Gene:Otud5 / 363452 RGDID:1563027 Length:640 Species:Rattus norvegicus


Alignment Length:160 Identity:40/160 - (25%)
Similarity:71/160 - (44%) Gaps:23/160 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 PKLIELQQ---ITAKLSQRQLSLHNIPSDGDCLYQSIRHQLIVNALPGHSVQELREETANYVRAH 216
            |..:|.|:   ..|...::...:..:..||.||::::..| :......|.|  :|:...:|:..:
  Rat   266 PATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQ-VYGDQDMHEV--VRKHCMDYLMKN 327

  Fly   217 KDSLISYMIHPETGDILNDQQFEQYCHDIAKTHAWGGHIELKAISSLLRVPIEVIQAEGAP--TL 279
            .|...:|:          .:.|..|.:...|.:..|.|||::|::.:...|:||.|....|  |.
  Rat   328 ADYFSNYV----------TEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYSTEPINTF 382

  Fly   280 LGQEEFGGSPLIICYHRHIYQLGAHYNSTV 309
            .|..:....|:.:.|||:|     ||||.|
  Rat   383 HGIHQNEDEPIRVSYHRNI-----HYNSVV 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 37/156 (24%)
OTU 178..305 CDD:280496 31/128 (24%)
Otud5XP_006256799.1 OTU 294..403 CDD:303090 31/126 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.