DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and Otud4

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001178629.1 Gene:Otud4 / 307774 RGDID:1305606 Length:1105 Species:Rattus norvegicus


Alignment Length:147 Identity:31/147 - (21%)
Similarity:65/147 - (44%) Gaps:28/147 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 RQLSLHN--IPSDGDCLYQSIRHQLIVNALPGHSVQ---ELREETANYVRAHKDSLISYMIHPET 229
            |:|.|:.  :..||.||::::..|::      ||..   |:|.....|:|.:::...:::     
  Rat    30 RKLGLYRKLVAKDGSCLFRAVAEQVL------HSQSRHVEVRMACIRYLRDNREKFEAFI----- 83

  Fly   230 GDILNDQQFEQYCHDIAKTHAWGGHIELKAISSLLRVPIEVIQAEG-APTLLGQEEFGGSPLIIC 293
                 :..||:|...:.....|.|.:|:.|:|.:.|....:.|... :|:.:.:..| ...:::|
  Rat    84 -----EGSFEEYLKRLENPQEWVGQVEISALSLMYRKDFVIYQEPNVSPSHVTENNF-PEKVLLC 142

  Fly   294 YHRHIYQLGAHYNSTVP 310
            :..     |.||:...|
  Rat   143 FSN-----GNHYDIVYP 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 30/142 (21%)
OTU 178..305 CDD:280496 25/130 (19%)
Otud4NP_001178629.1 OTU 42..>121 CDD:303090 20/94 (21%)
T4BSS_DotH_IcmK 556..>642 CDD:289093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338855
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.