DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and Nuf2

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001012028.1 Gene:Nuf2 / 304951 RGDID:1307952 Length:464 Species:Rattus norvegicus


Alignment Length:150 Identity:33/150 - (22%)
Similarity:63/150 - (42%) Gaps:14/150 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LQAKLQAMKKNAPKNNKNKRKEFLEEMARLEGELEQRHKAELKAAEAMEAPVLVEPVVKEPAEKP 98
            |:.:|...|.....:|:.|....|:|...|||:::. ..:|||..:..|     ..:::....|.
  Rat   291 LEVQLYQKKSQDLADNREKLSSILKESLNLEGQIDS-DSSELKKLKTEE-----NSLIRLMTLKK 349

  Fly    99 ETEVTDDDGIEEKEEQLAPNQRV-----SKAQKRRDKKAKEARAREAE---IKTELQNAANQPTP 155
            |...|....|.:|:|.:...:|.     :|.|::||...::..|...:   ||:.:|...:....
  Rat   350 ERLATMQFKINKKQEDVKQYKRTMIEDCNKVQEKRDAVCEQVTAINQDIHKIKSGIQQLRDAEKR 414

  Fly   156 KLIELQQITAKLSQRQLSLH 175
            :.::.|:|...|.......|
  Rat   415 EKLKSQEILVDLKSALEKYH 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 32/149 (21%)
OTU 178..305 CDD:280496
Nuf2NP_001012028.1 Interaction with the N-terminus of NDC80. /evidence=ECO:0000250 1..385 23/99 (23%)
Nuf2 3..146 CDD:281753
COG1340 175..443 CDD:224259 32/149 (21%)
Interaction with the C-terminus of NDC80 and the SPBC24-SPBC25 subcomplex. /evidence=ECO:0000250 386..464 7/48 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.