DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and otu1

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_594039.1 Gene:otu1 / 2542649 PomBaseID:SPAC24C9.14 Length:329 Species:Schizosaccharomyces pombe


Alignment Length:200 Identity:54/200 - (27%)
Similarity:77/200 - (38%) Gaps:38/200 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 KKAKEARAREAEIKTELQNAANQPT-PKLIELQQITAKLSQRQ---------------LSLHNIP 178
            |.|..:.:.....|..:.|||.:|| |...|:....|...|.:               ::|..:|
pombe    77 KNAATSFSTNEPAKPPIPNAATKPTFPPQTEISNPPAVSHQSKNTSQDPPYVSTPIGDIALRVMP 141

  Fly   179 SDGDCLYQSIRHQLIVNALPGHSVQELREETANYVRAHKDSLISYMIHPETGDILNDQQFEQYCH 243
            .|..||::::...|      |.|..||||..||.|.::.|      |:...  ||.....| |..
pombe   142 DDNSCLFRALSKPL------GFSPYELREIVANQVLSNPD------IYSTA--ILGKPSIE-YAS 191

  Fly   244 DIAKTHAWGGHIELKAISSLLRVPIEVIQAE-GAPTLLGQEEFGGSPLIICYHRHIYQLGAHYNS 307
            .|.|..:|||:|||..:||...|.|..:..: |.......:...|....|.|.      |.||:.
pombe   192 WIRKETSWGGYIELSILSSHFGVEICSVDVKTGRVDSYNPQPATGQRTYIVYS------GIHYDL 250

  Fly   308 TVPAA 312
            ...||
pombe   251 AALAA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 52/193 (27%)
OTU 178..305 CDD:280496 37/127 (29%)
otu1NP_594039.1 COG5539 7..329 CDD:227826 53/199 (27%)
OTU 141..249 CDD:303090 38/128 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.