DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and OTUD1

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001138845.1 Gene:OTUD1 / 220213 HGNCID:27346 Length:481 Species:Homo sapiens


Alignment Length:196 Identity:50/196 - (25%)
Similarity:81/196 - (41%) Gaps:45/196 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PETEVTDDDGIEEKEEQLAPNQRVSKAQKRRDKKAKEARAREAEIKTELQNAANQPTPKLIELQQ 162
            ||.|......||......|....||::..|.:|.|.                      .|.|:::
Human   257 PEAEAPPAGSIEAAPSSAAEPVIVSRSDPRDEKLAL----------------------YLAEVEK 299

  Fly   163 ITAKLSQR-QLSLHNIPSDGDCLYQSIRHQLIVNALPGHSVQELREETANYVRAHKDSLISYMIH 226
            ....|.|| :...|.|| ||:|||::: .:.:......|  :||||:|.:|:..|.|. .|.:|.
Human   300 QDKYLRQRNKYRFHIIP-DGNCLYRAV-SKTVYGDQSLH--RELREQTVHYIADHLDH-FSPLIE 359

  Fly   227 PETGDILNDQQFEQYCHDIAKTHAWGGHIELKAISSLLRVPIEV-----IQAEGAPTL---LGQE 283
            .:.|         ::....|:..||.|:.||.|:..:|.|.|.:     :::....|:   ||.|
Human   360 GDVG---------EFIIAAAQDGAWAGYPELLAMGQMLNVNIHLTTGGRLESPTVSTMIHYLGPE 415

  Fly   284 E 284
            :
Human   416 D 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 50/196 (26%)
OTU 178..305 CDD:280496 32/115 (28%)
OTUD1NP_001138845.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..60
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..282 7/24 (29%)
Cys-loop 314..320 4/6 (67%)
OTU 315..432 CDD:280496 33/116 (28%)
His-loop 369..379 4/9 (44%)
Variable-loop 426..431
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.