Sequence 1: | NP_648769.2 | Gene: | CG7857 / 39671 | FlyBaseID: | FBgn0026738 | Length: | 312 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001138845.1 | Gene: | OTUD1 / 220213 | HGNCID: | 27346 | Length: | 481 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 50/196 - (25%) |
---|---|---|---|
Similarity: | 81/196 - (41%) | Gaps: | 45/196 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 PETEVTDDDGIEEKEEQLAPNQRVSKAQKRRDKKAKEARAREAEIKTELQNAANQPTPKLIELQQ 162
Fly 163 ITAKLSQR-QLSLHNIPSDGDCLYQSIRHQLIVNALPGHSVQELREETANYVRAHKDSLISYMIH 226
Fly 227 PETGDILNDQQFEQYCHDIAKTHAWGGHIELKAISSLLRVPIEV-----IQAEGAPTL---LGQE 283
Fly 284 E 284 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7857 | NP_648769.2 | COG5539 | 17..307 | CDD:227826 | 50/196 (26%) |
OTU | 178..305 | CDD:280496 | 32/115 (28%) | ||
OTUD1 | NP_001138845.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 18..60 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 202..282 | 7/24 (29%) | |||
Cys-loop | 314..320 | 4/6 (67%) | |||
OTU | 315..432 | CDD:280496 | 33/116 (28%) | ||
His-loop | 369..379 | 4/9 (44%) | |||
Variable-loop | 426..431 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |