Sequence 1: | NP_648769.2 | Gene: | CG7857 / 39671 | FlyBaseID: | FBgn0026738 | Length: | 312 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_500333.3 | Gene: | otub-4 / 177104 | WormBaseID: | WBGene00015249 | Length: | 436 | Species: | Caenorhabditis elegans |
Alignment Length: | 258 | Identity: | 60/258 - (23%) |
---|---|---|---|
Similarity: | 93/258 - (36%) | Gaps: | 94/258 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 83 APVLVEPVVKEPAEKPETEVTDDDGIEEKEEQLAPN--QRVSKAQKRRDKKAKEARAREAEIKTE 145
Fly 146 LQNAANQPTPKLIELQQITAKLSQRQLSLHNIPSDGDCLYQSIRHQLIVNALPGHSVQE----LR 206
Fly 207 EETANYVRAHKDSLISYMIHPETGDILNDQQFEQYCHDIAKTHAWGGHIELKAISSLLRVPIEVI 271
Fly 272 QAEGAP--TLLGQEE------FGGS-------------------PLIICYHRHIYQLGAHYNS 307 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7857 | NP_648769.2 | COG5539 | 17..307 | CDD:227826 | 59/256 (23%) |
OTU | 178..305 | CDD:280496 | 36/157 (23%) | ||
otub-4 | NP_500333.3 | OTU | 142..277 | CDD:388712 | 36/156 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |