Sequence 1: | NP_648769.2 | Gene: | CG7857 / 39671 | FlyBaseID: | FBgn0026738 | Length: | 312 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001293463.1 | Gene: | duo-3 / 172925 | WormBaseID: | WBGene00001112 | Length: | 924 | Species: | Caenorhabditis elegans |
Alignment Length: | 200 | Identity: | 45/200 - (22%) |
---|---|---|---|
Similarity: | 79/200 - (39%) | Gaps: | 60/200 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 LVEPVVKEPAEKPETEVTDDDGIEEKEEQLAPNQRVSKAQKRRDKKAKEARAREAEIKTELQNAA 150
Fly 151 NQPTPKLIELQQITAKLSQRQLSLHNIPSDGDCLYQSIRHQLIVNALPGHSVQELREETANYVRA 215
Fly 216 HKDSLISYMIHPETGDILNDQQF-EQYCHDI-AKTHA--------WGGHIELKAISSLLRVPIEV 270
Fly 271 IQAEG 275 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7857 | NP_648769.2 | COG5539 | 17..307 | CDD:227826 | 44/199 (22%) |
OTU | 178..305 | CDD:280496 | 27/107 (25%) | ||
duo-3 | NP_001293463.1 | Peptidase_C19Q | 303..>554 | CDD:239138 | |
Peptidase_C19 | 304..>426 | CDD:271592 | |||
OTU | 669..786 | CDD:303090 | 27/106 (25%) | ||
Peptidase_C19 | <812..922 | CDD:271592 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |