DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and duo-3

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001293463.1 Gene:duo-3 / 172925 WormBaseID:WBGene00001112 Length:924 Species:Caenorhabditis elegans


Alignment Length:200 Identity:45/200 - (22%)
Similarity:79/200 - (39%) Gaps:60/200 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LVEPVVKEPAEKPETEVTDDDGIEEKEEQLAPNQRVSKAQKRRDKKAKEARAREAEIKTELQNAA 150
            :::.|||.|..  ...:||.|.||:.       .:::....|||           ::|..::...
 Worm   604 MMKEVVKNPLH--FKWLTDLDEIEQM-------LKLTNITYRRD-----------DVKIHVEKLE 648

  Fly   151 NQPTPKLIELQQITAKLSQRQLSLHNIPSDGDCLYQSIRHQLIVNALPGHSVQELREETANYVRA 215
            |:        :.:..|...|...:..|.|||:|.|::| ...:..:...|  :.||..||||:| 
 Worm   649 NE--------KSVVMKKFDRPGRVKGIESDGNCFYRAI-SWCLTGSQKYH--KALRIATANYLR- 701

  Fly   216 HKDSLISYMIHPETGDILNDQQF-EQYCHDI-AKTHA--------WGGHIELKAISSLLRVPIEV 270
                              ||... ::|||.. .||:.        |..::|:..:::||.|.|..
 Worm   702 ------------------NDIAIVDKYCHKTDHKTYVQQVEGDGWWATNVEICVMANLLNVNIYT 748

  Fly   271 IQAEG 275
            ..::|
 Worm   749 FLSDG 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 44/199 (22%)
OTU 178..305 CDD:280496 27/107 (25%)
duo-3NP_001293463.1 Peptidase_C19Q 303..>554 CDD:239138
Peptidase_C19 304..>426 CDD:271592
OTU 669..786 CDD:303090 27/106 (25%)
Peptidase_C19 <812..922 CDD:271592
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.