DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and AgaP_AGAP002086

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_320955.4 Gene:AgaP_AGAP002086 / 1281343 VectorBaseID:AGAP002086 Length:717 Species:Anopheles gambiae


Alignment Length:349 Identity:72/349 - (20%)
Similarity:125/349 - (35%) Gaps:127/349 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ELESRLDEVSLEDIGA-----RHRRERKD---------------LQAKLQAMKKN---------- 44
            |:....:|...||:|.     .|:||.::               ||......|::          
Mosquito    77 EIRRIFEEEEEEDLGRLKRDHYHKRESREREKATGSPSYHHHVVLQPSASGKKQSTACSSTLASA 141

  Fly    45 -----APKNNKNKRKEFLEEMARLEGELEQRHKAEL--KAAEAMEAPVLVEPVVKEPAEKPETEV 102
                 :||:.        .:.....|.|...|:|.:  ..|..::...::|            ||
Mosquito   142 AGGGRSPKST--------HQSGGAGGSLLNSHQAVVGSPGASGVDLNAVLE------------EV 186

  Fly   103 -----TDDDGIEEKEEQLAPNQRVSKAQKRRDKKAKEARAREAEIKTELQNAANQPTPKLIELQQ 162
                 :.|:.|:.|:.||..::     .|:||    ||.|:                        
Mosquito   187 RSGYNSGDEYIDSKDAQLTADE-----WKKRD----EAFAK------------------------ 218

  Fly   163 ITAKLSQRQLSLHNIPSDGDCLYQSIRHQLIVNALPGHSVQE----LREETANYVRAHKDSLISY 223
               .||:|...||.:..||.||:::|..|:       :..||    :|::|.:|:..:::....:
Mosquito   219 ---VLSERGFILHEMEEDGACLFRAISLQI-------YGDQEMHEAIRQQTMDYIYQNREYFAQF 273

  Fly   224 MIHPETGDILNDQQFEQYCHDIAKTHAWGGHIELKAISSLLRVPIEVIQAEGAPTLL---GQEEF 285
            :    |.||.:      |.......|..|.|||::|:|.:....:|:...:..||.:   .|...
Mosquito   274 V----TEDIAD------YVERKRANHVHGNHIEIQAMSEMYNRSVELYCYQTEPTNIFNSDQINN 328

  Fly   286 GGSPLIICYHRHIYQLGAHYNSTV 309
            |..|.     |..||..:|||:.|
Mosquito   329 GNEPF-----RLSYQRSSHYNAIV 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 69/338 (20%)
OTU 178..305 CDD:280496 31/133 (23%)
AgaP_AGAP002086XP_320955.4 OTU 233..343 CDD:303090 31/131 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.