DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and AgaP_AGAP004972

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_315069.4 Gene:AgaP_AGAP004972 / 1275782 VectorBaseID:AGAP004972 Length:336 Species:Anopheles gambiae


Alignment Length:102 Identity:25/102 - (24%)
Similarity:48/102 - (47%) Gaps:23/102 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 DGDCLYQSIRHQLIVNALPGHSVQ----ELREETANYVRAHKDSLISYMIHPETGDILNDQQFEQ 240
            |...|::.:..|       .:|:|    |:|::..||:||::...        ..||..|  ||.
Mosquito    35 DSSSLFRVVSEQ-------QYSIQLHHEEVRKQCVNYMRANRAQF--------KKDIKWD--FEG 82

  Fly   241 YCHDIAKTHAWGGHIELKAISSLLRVPIEVIQ--AEG 275
            |..::::....|..:||||::.|.:..:.:.:  |:|
Mosquito    83 YLENMSRLKTHGTLVELKALAHLHKANVRLFEPFADG 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 25/102 (25%)
OTU 178..305 CDD:280496 25/102 (25%)
AgaP_AGAP004972XP_315069.4 OTU 35..>105 CDD:303090 22/86 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.