DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and AgaP_AGAP007001

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_308769.2 Gene:AgaP_AGAP007001 / 1270099 VectorBaseID:AGAP007001 Length:315 Species:Anopheles gambiae


Alignment Length:213 Identity:47/213 - (22%)
Similarity:83/213 - (38%) Gaps:54/213 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 ETEVTDDDGI-EEKEEQLAPNQRVSKAQKRRDKKAKEARAREAEIKTELQNAANQPTPKLIELQQ 162
            :|.:.::..: ||:.:||...:|:    ::.:|.|||..|:..|....|....            
Mosquito    74 DTLIVEEKSLTEEERKQLEATKRL----EQDEKLAKELAAQGTESGGILLKCV------------ 122

  Fly   163 ITAKLSQRQLSLHNIPSDGDCLYQSIRHQLIVNALPGHSVQELREETANYVRAHKDSLISYMIHP 227
                          :|||..||:.||.: :|...:.....|.:|:..|:.|...|        |.
Mosquito   123 --------------VPSDNSCLFTSIGY-VITGKVDPDGAQYMRQIIASTVNGDK--------HE 164

  Fly   228 ETGDIL---NDQQFEQYCHDIAKTHAWGGHIELKAISSLLRVPIEVIQAEGA-PTLLGQEEFGGS 288
            ....||   ||    :||..|.:..:|||.||:..:|:...:..:|:....| ....|:::..|.
Mosquito   165 YNEGILGRPND----EYCAWILQPESWGGAIEVSILSAYYGLEFDVVDITNAIINRFGEDKNYGM 225

  Fly   289 PLIICYHRHIYQLGAHYN 306
            ...:.:.      |.||:
Mosquito   226 RGFLLFD------GIHYD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 47/213 (22%)
OTU 178..305 CDD:280496 32/130 (25%)
AgaP_AGAP007001XP_308769.2 UBQ 5..81 CDD:294102 1/6 (17%)
COG5539 34..314 CDD:227826 47/213 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.