DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and alg13

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_002938835.2 Gene:alg13 / 100145625 XenbaseID:XB-GENE-22172432 Length:855 Species:Xenopus tropicalis


Alignment Length:153 Identity:32/153 - (20%)
Similarity:61/153 - (39%) Gaps:33/153 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 QQITAKLSQRQLSLHNIPSDGDCLYQSIRHQLIVNALPGHSVQELREETANYVRAHKDSLISYMI 225
            :::|||             |..||::::..||....:  |. .|:|:...:|:|.:::...||:.
 Frog    30 RKLTAK-------------DASCLFRAVSEQLFFCQI--HH-PEIRKICVSYMRQNQELFESYVE 78

  Fly   226 HPETGDILNDQQFEQYCHDIAKTHAWGGHIELKAISSLLRVPIEVIQAEG-APTLLGQEEFGGSP 289
            .|          ||:|...:.......|.:|:.|:|.:......:.::.| .||......:.|..
 Frog    79 GP----------FEKYLERLEDPKESAGQLEITALSLIFNQDFILYKSPGKQPTYATDNNWEGKI 133

  Fly   290 LIICYHRHIYQLGAHYNSTVPAA 312
            ::.|      ....||:|....|
 Frog   134 MLCC------SSNGHYDSVFTKA 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 30/146 (21%)
OTU 178..305 CDD:280496 25/127 (20%)
alg13XP_002938835.2 OTU 36..>116 CDD:388712 20/92 (22%)
TUDOR 299..347 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.