DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7276 and DYNLT2

DIOPT Version :9

Sequence 1:NP_996092.1 Gene:CG7276 / 39668 FlyBaseID:FBgn0036499 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_777570.1 Gene:DYNLT2 / 6991 HGNCID:11695 Length:198 Species:Homo sapiens


Alignment Length:139 Identity:36/139 - (25%)
Similarity:63/139 - (45%) Gaps:8/139 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SHSDSDEEWEPGNEDKPASDVTIYNYYNMGPAFGKKFPLPYIRLMIAQVVKEKLANKTYNQSEAL 95
            |.:|..:||:     ...:.:...|.|.|.|.  |||....:...:.|::.|.|.:..|:.....
Human    66 SIADIGKEWK-----SALAKLKFANSYRMEPL--KKFQAHSVETKVQQILTESLKDVKYDDKVFS 123

  Fly    96 KWTREVADDINIKMKGRGSSPRFKHVVNVMLYQQTGAGCFYGARAIWDELSDDYITFTFDGGSFI 160
            ..:.|:||.|.:.:|..|.. |:|.::.|:..|:||......:|.|||...|.::....:..|::
Human   124 HLSLELADRILLAVKEFGYH-RYKFIIKVLFIQKTGQAINIASRWIWDIAWDSWVAAKHEAESYV 187

  Fly   161 CIAAVFGCY 169
            .:..||..|
Human   188 ALVLVFALY 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7276NP_996092.1 Tctex-1 72..169 CDD:281624 24/96 (25%)
DYNLT2NP_777570.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
VirB10_like <11..>72 CDD:330184 2/5 (40%)
Tctex-1 100..196 CDD:308957 24/96 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4108
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6688
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.