DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7276 and Dynlt5

DIOPT Version :9

Sequence 1:NP_996092.1 Gene:CG7276 / 39668 FlyBaseID:FBgn0036499 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001361635.1 Gene:Dynlt5 / 67344 MGIID:1914594 Length:177 Species:Mus musculus


Alignment Length:179 Identity:44/179 - (24%)
Similarity:77/179 - (43%) Gaps:29/179 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AKESF------RASAVSADSRS--------------EVMSHSDSDEEWEPGNEDKPAS-DVTIYN 55
            |||..      |.|..|.::|.              ..:||:|     ||...|:.:. .|.:.|
Mouse     5 AKEKLFLAMKKRGSMCSPNNREFRQKEGHWRIKHSLSTVSHAD-----EPSQRDESSRLTVRMEN 64

  Fly    56 YYNMGPAFGKKFPLPYIRLMIAQVVKEKLANKTYNQSEALKWTREVADDINIKMKGRGSSPRFKH 120
            .|.:||.  |.||:..:..::..|:...|....|:.....:.|:.:::.|..::| ....||:|.
Mouse    65 TYQLGPT--KPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVK-ELVIPRYKL 126

  Fly   121 VVNVMLYQQTGAGCFYGARAIWDELSDDYITFTFDGGSFICIAAVFGCY 169
            :|.|.:.|:.......|:|.:|:..||...::||...:|..:|.|:..|
Mouse   127 IVIVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAVY 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7276NP_996092.1 Tctex-1 72..169 CDD:281624 22/96 (23%)
Dynlt5NP_001361635.1 Tctex-1 79..175 CDD:367593 22/96 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6021
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.