DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7276 and Dynlt2b

DIOPT Version :9

Sequence 1:NP_996092.1 Gene:CG7276 / 39668 FlyBaseID:FBgn0036499 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_079605.1 Gene:Dynlt2b / 66061 MGIID:1913311 Length:144 Species:Mus musculus


Alignment Length:159 Identity:52/159 - (32%)
Similarity:78/159 - (49%) Gaps:20/159 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SFRASAVSADSR--SEVMSHSDSDEEWEPGNEDKPASDVTIYNYYNMGPAFGKKFPLPYIRLMIA 77
            |||..::||.|.  |||..:|...|                 |.|.:.|.|.::|....::..|.
Mouse     4 SFRGLSLSAHSEGLSEVDKNSGEPE-----------------NTYILRPIFQQRFRPSVVKDCIH 51

  Fly    78 QVVKEKLANKTYNQSEALKWTREVADDINIKMKGRGSSPRFKHVVNVMLYQQTGAGCFYGARAIW 142
            .|:||:||:..|:..|..:.|:.:::.|..|:|..|.. |:|.||.|::.:|.|.|.|..||..|
Mouse    52 TVLKEELASAEYSPDEMPQLTKRLSEMIKDKLKELGYD-RYKMVVQVVIGEQRGEGVFMAARCFW 115

  Fly   143 DELSDDYITFTFDGGSFICIAAVFGCYQY 171
            |..:|:|....|...|..|:.|.|||:.|
Mouse   116 DADTDNYTHDVFMNDSLFCVVAAFGCFYY 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7276NP_996092.1 Tctex-1 72..169 CDD:281624 34/96 (35%)
Dynlt2bNP_079605.1 Tctex-1 46..142 CDD:281624 34/96 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9618
eggNOG 1 0.900 - - E1_KOG4108
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5149
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56346
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006460
OrthoInspector 1 1.000 - - otm43160
orthoMCL 1 0.900 - - OOG6_101459
Panther 1 1.100 - - O PTHR21255
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3738
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.