DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7276 and Dynlt2b

DIOPT Version :9

Sequence 1:NP_996092.1 Gene:CG7276 / 39668 FlyBaseID:FBgn0036499 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001102524.1 Gene:Dynlt2b / 498095 RGDID:1563597 Length:145 Species:Rattus norvegicus


Alignment Length:157 Identity:49/157 - (31%)
Similarity:77/157 - (49%) Gaps:15/157 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SFRASAVSADSRSEVMSHSDSDEEWEPGNEDKPASDVTIYNYYNMGPAFGKKFPLPYIRLMIAQV 79
            |.|..:::|.: ||.:|.:|. ...||.|.            |.:.|.|.::|....::..|..|
  Rat     4 SVRGQSLTAGA-SEGLSEADK-TSGEPENT------------YILRPIFQQRFRPSVVKDCIHTV 54

  Fly    80 VKEKLANKTYNQSEALKWTREVADDINIKMKGRGSSPRFKHVVNVMLYQQTGAGCFYGARAIWDE 144
            :||:|....|:..|..:.|:.:::.|..|:|..|.. |:|.||.|::.:|.|.|.|..||..||.
  Rat    55 LKEELTGAEYSPEEMPQLTKRLSEMIKDKLKELGYD-RYKMVVQVVIGEQRGEGVFMAARCFWDA 118

  Fly   145 LSDDYITFTFDGGSFICIAAVFGCYQY 171
            .:|:|....|...|..|:.|.|||:.|
  Rat   119 DTDNYTHDVFMNDSLFCVVAAFGCFYY 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7276NP_996092.1 Tctex-1 72..169 CDD:281624 33/96 (34%)
Dynlt2bNP_001102524.1 Tctex-1 47..143 CDD:281624 33/96 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4108
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434909at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.