DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7276 and dynlt5

DIOPT Version :9

Sequence 1:NP_996092.1 Gene:CG7276 / 39668 FlyBaseID:FBgn0036499 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001004623.1 Gene:dynlt5 / 447884 ZFINID:ZDB-GENE-040912-49 Length:173 Species:Danio rerio


Alignment Length:169 Identity:40/169 - (23%)
Similarity:76/169 - (44%) Gaps:14/169 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QRPKTLSTAKESFRASAVSADSRSEVMSHSDSDEEWEPGNED---KPASDVTIYNYYNMGPAFGK 65
            :|....|......||...:.||.| .:|:.:     |.|:.|   :|.  |.:.|.|.:.|:  :
Zfish    14 KRGSLSSLGSHEVRAIGKTKDSIS-TLSYME-----EHGHHDDIQRPT--VQMENTYRITPS--R 68

  Fly    66 KFPLPYIRLMIAQVVKEKLANKTYNQSEALKWTREVADDINIKMKGRGSSPRFKHVVNVMLYQQT 130
            :||:..::.::..|:...|..:.|......:.|:.:.:.:..::|.. ..||:|.:|.:.:.|..
Zfish    69 RFPVLTVKDLLKDVLTSYLQEEKYETELCRQMTKTITEVVKARVKDL-MIPRYKIIVVISIGQIK 132

  Fly   131 GAGCFYGARAIWDELSDDYITFTFDGGSFICIAAVFGCY 169
            ......|:|.:||:..|::.:..|...|....|.|||.|
Zfish   133 DQNIRMGSRCLWDDNHDNFSSHIFKNNSLFAAATVFGVY 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7276NP_996092.1 Tctex-1 72..169 CDD:281624 21/96 (22%)
dynlt5NP_001004623.1 Tctex-1 75..171 CDD:281624 21/96 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6340
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6021
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.