DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7276 and CG5359

DIOPT Version :9

Sequence 1:NP_996092.1 Gene:CG7276 / 39668 FlyBaseID:FBgn0036499 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001163579.1 Gene:CG5359 / 41222 FlyBaseID:FBgn0037773 Length:173 Species:Drosophila melanogaster


Alignment Length:171 Identity:66/171 - (38%)
Similarity:93/171 - (54%) Gaps:8/171 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STQRPKTLSTAKESFRASAVSADSRSEVMSHSDSDEEWE-PGNEDKPASDVTIYNYYNMGPAFGK 65
            :|:..:||:....:.|.|..||..    ..||.|.:..| ....:||....|.   |:|.||||:
  Fly    10 TTKSVQTLTVPNPADRKSEKSASG----SLHSGSADGLENQEKSEKPGDQPTA---YSMRPAFGE 67

  Fly    66 KFPLPYIRLMIAQVVKEKLANKTYNQSEALKWTREVADDINIKMKGRGSSPRFKHVVNVMLYQQT 130
            .||||.|:.::..|:.|||.:|||::..|.|||.|:||::|.::.......|:||||.|||.|:.
  Fly    68 MFPLPTIKSIMNNVMAEKLKDKTYDKDVAKKWTSEIADEVNQQIASSSLVKRYKHVVQVMLGQEL 132

  Fly   131 GAGCFYGARAIWDELSDDYITFTFDGGSFICIAAVFGCYQY 171
            |||..|.:|..||...|..::..|...|..|:..|||.|||
  Fly   133 GAGATYNSRCCWDCDCDTSVSEVFSNTSLFCVCTVFGTYQY 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7276NP_996092.1 Tctex-1 72..169 CDD:281624 39/96 (41%)
CG5359NP_001163579.1 Tctex-1 74..171 CDD:281624 39/96 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468509
Domainoid 1 1.000 70 1.000 Domainoid score I9517
eggNOG 1 0.900 - - E1_KOG4108
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5217
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434909at2759
OrthoFinder 1 1.000 - - FOG0006460
OrthoInspector 1 1.000 - - mtm6340
orthoMCL 1 0.900 - - OOG6_101459
Panther 1 1.100 - - P PTHR21255
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3738
SonicParanoid 1 1.000 - - X6021
1211.830

Return to query results.
Submit another query.