DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7276 and dynlt3

DIOPT Version :9

Sequence 1:NP_996092.1 Gene:CG7276 / 39668 FlyBaseID:FBgn0036499 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_991171.1 Gene:dynlt3 / 402901 ZFINID:ZDB-GENE-040927-24 Length:115 Species:Danio rerio


Alignment Length:94 Identity:24/94 - (25%)
Similarity:46/94 - (48%) Gaps:6/94 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 AQVVKE----KLANKTYNQSEALKWTREVADDINIKMKGRGSSPRFKHVVNVMLYQQTGAGCFYG 137
            :.||||    .:....|:|::..:||..:.:....::..:|..  ||::||..:.|::|||....
Zfish    18 SNVVKECIEGIIGGVDYSQNKVNQWTASIVEHSLTQLVKQGKP--FKYIVNCAVMQKSGAGLHTA 80

  Fly   138 ARAIWDELSDDYITFTFDGGSFICIAAVF 166
            ....||..:|...|..::..:..|:.:||
Zfish    81 NSCYWDTTTDGSCTVRWENRTMYCVVSVF 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7276NP_996092.1 Tctex-1 72..169 CDD:281624 24/94 (26%)
dynlt3NP_991171.1 Tctex-1 16..112 CDD:281624 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.