DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7276 and Dynlt2

DIOPT Version :9

Sequence 1:NP_996092.1 Gene:CG7276 / 39668 FlyBaseID:FBgn0036499 Length:171 Species:Drosophila melanogaster
Sequence 2:XP_006228033.1 Gene:Dynlt2 / 365153 RGDID:1310947 Length:193 Species:Rattus norvegicus


Alignment Length:188 Identity:43/188 - (22%)
Similarity:78/188 - (41%) Gaps:28/188 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STQRPKTLSTAKESFRASAVSADSRSEVM--------------------SHSDSDEEWEPGNEDK 46
            |||..::..::|...|.|....:|.::::                    |.:|..:||:     .
  Rat    12 STQTHQSPVSSKRERRPSMFEKESYAQILRERLRESFHDVQYVEPPFDDSIADLGKEWK-----S 71

  Fly    47 PASDVTIYNYYNMGPAFGKKFPLPYIRLMIAQVVKEKLANKTYNQSEALKWTREVADDINIKMKG 111
            ..:.:...|.|.|.|.  |||....:...|.|::|..|.:..|:.......:.|:||.|...:| 
  Rat    72 ALAKLKFANSYRMEPL--KKFQAHSVETKIQQILKASLKDVKYDDKAFSHLSLELADRILAAVK- 133

  Fly   112 RGSSPRFKHVVNVMLYQQTGAGCFYGARAIWDELSDDYITFTFDGGSFICIAAVFGCY 169
            ..:..|:|.::.|:..|:||......:|.|||...|.::....:..|::.:..||..|
  Rat   134 EFAFHRYKFIIKVLFIQKTGQAINIVSRWIWDVAWDSWVEAKHETESYLALVLVFALY 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7276NP_996092.1 Tctex-1 72..169 CDD:281624 24/96 (25%)
Dynlt2XP_006228033.1 Tctex-1 95..191 CDD:281624 24/96 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4108
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.