DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7276 and Dynlt5

DIOPT Version :9

Sequence 1:NP_996092.1 Gene:CG7276 / 39668 FlyBaseID:FBgn0036499 Length:171 Species:Drosophila melanogaster
Sequence 2:XP_006238521.1 Gene:Dynlt5 / 362553 RGDID:1311932 Length:178 Species:Rattus norvegicus


Alignment Length:141 Identity:37/141 - (26%)
Similarity:69/141 - (48%) Gaps:9/141 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 MSHSDSDEEWEPGNEDKPAS-DVTIYNYYNMGPAFGKKFPLPYIRLMIAQVVKEKLANKTYNQSE 93
            :||||     ||.:.|:.:. .|.:.|.|.:||.  |.||:..:..::..|:...|....|:...
  Rat    44 VSHSD-----EPSHHDESSGLQVRMENTYQLGPT--KPFPVATVNRILEDVLTTYLQEAKYDPEF 101

  Fly    94 ALKWTREVADDINIKMKGRGSSPRFKHVVNVMLYQQTGAGCFYGARAIWDELSDDYITFTFDGGS 158
            ..:.|:.:::.|..::| :...||:|.:|.|.:.|:.......|:|.:|:..||...::||...:
  Rat   102 CRQMTKTISEVIKTQVK-QLMIPRYKLIVTVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNPT 165

  Fly   159 FICIAAVFGCY 169
            ...:|.|:..|
  Rat   166 LFALANVYAVY 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7276NP_996092.1 Tctex-1 72..169 CDD:281624 21/96 (22%)
Dynlt5XP_006238521.1 Tctex-1 80..176 CDD:281624 21/96 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10506
eggNOG 1 0.900 - - E1_KOG4108
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45822
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6021
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.