DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7276 and CG14763

DIOPT Version :9

Sequence 1:NP_996092.1 Gene:CG7276 / 39668 FlyBaseID:FBgn0036499 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001286175.1 Gene:CG14763 / 35757 FlyBaseID:FBgn0033243 Length:189 Species:Drosophila melanogaster


Alignment Length:160 Identity:28/160 - (17%)
Similarity:64/160 - (40%) Gaps:26/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DSDEEWEPGNEDKPASD---VTIYNYYNMGPAFGKKFPLPYIRLM---------------IAQVV 80
            :..|:...|.:.:|||.   ....::..:....|.....|.:|.|               :..::
  Fly    30 EKKEKSAEGTKPRPASSQRGSLTKSHMGVSLPMGAPAAKPTMRFMPTYRLESKNPLNKERVENII 94

  Fly    81 KEKLANKTYNQ------SEALKWTREVADDINIKMKGRGSSPRFKHVVNVMLYQQTGAGCFYGAR 139
            | .:.|:.||.      ..:|....:|:::|..::| ..:..|::::|.|.:.:....|.:....
  Fly    95 K-AVMNRHYNDEYMFHPKHSLHMAAQVSEEIKNRIK-LDNYDRYRYIVLVTVGEFLMQGLYSMVN 157

  Fly   140 AIWDELSDDYITFTFDGGSFICIAAVFGCY 169
            .:||...|.::|::.:..|:..:...|..|
  Fly   158 FLWDAEKDGFVTYSVERPSYFAVCTTFYLY 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7276NP_996092.1 Tctex-1 72..169 CDD:281624 20/117 (17%)
CG14763NP_001286175.1 DLC-like_SF 86..186 CDD:425407 18/101 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440459
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4108
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6688
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21255
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.