DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7276 and CG12836

DIOPT Version :9

Sequence 1:NP_996092.1 Gene:CG7276 / 39668 FlyBaseID:FBgn0036499 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001286153.2 Gene:CG12836 / 35630 FlyBaseID:FBgn0033140 Length:174 Species:Drosophila melanogaster


Alignment Length:181 Identity:32/181 - (17%)
Similarity:82/181 - (45%) Gaps:24/181 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STQRPKTLSTAKESFRASAVSAD---SRSEVMSHSDSD----EEWEPGNEDKPASDVTIYN-YYN 58
            :|.:.:..::.:.:.|.:|:.::   ||.....:.:.:    |..|| .::||.:|...:: .:|
  Fly     5 TTMKTRITASVRTTNRMNALLSESMLSRRRAAQNPEGEATGGEAGEP-RKEKPKNDWKFFHTNFN 68

  Fly    59 MGPAFGKKFPLPYIRLMIAQVVKEKLA----NKTYNQSEALKWTREVADDINIKMKGRGSSPRFK 119
            |..|          :.:|...::|:|.    ::.|:...||:....:|.:|..::| :.:..|.:
  Fly    69 MERA----------QKIIEDCIEERLLWDRFSRNYDSWRALQLAEGLAAEIRDRVK-KLNHRRHR 122

  Fly   120 HVVNVMLYQQTGAGCFYGARAIWDELSDDYITFTFDGGSFICIAAVFGCYQ 170
            .|..:.:.::...|.:.....:.||..|::....|:..::..|..::..|:
  Fly   123 IVCLLSIVEKQNQGVYQRMCHLMDEKRDNFTQLVFERPTYFMIVVLYLVYK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7276NP_996092.1 Tctex-1 72..169 CDD:281624 17/100 (17%)
CG12836NP_001286153.2 Tctex-1 71..172 CDD:281624 18/111 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468510
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21255
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.