DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7276 and DYNLT2B

DIOPT Version :9

Sequence 1:NP_996092.1 Gene:CG7276 / 39668 FlyBaseID:FBgn0036499 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001338557.1 Gene:DYNLT2B / 255758 HGNCID:28482 Length:148 Species:Homo sapiens


Alignment Length:95 Identity:33/95 - (34%)
Similarity:55/95 - (57%) Gaps:1/95 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 NYYNMGPAFGKKFPLPYIRLMIAQVVKEKLANKTYNQSEALKWTREVADDINIKMKGRGSSPRFK 119
            |.|.:.|.|.::|....::..|..|:||:|||..|:..|..:.|:.::::|..|:|..|.. |:|
Human    27 NTYILRPVFQQRFRPSVVKDCIHAVLKEELANAEYSPEEMPQLTKHLSENIKDKLKEMGFD-RYK 90

  Fly   120 HVVNVMLYQQTGAGCFYGARAIWDELSDDY 149
            .||.|::.:|.|.|.|..:|..||..:|:|
Human    91 MVVQVVIGEQRGEGVFMASRCFWDADTDNY 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7276NP_996092.1 Tctex-1 72..169 CDD:281624 28/78 (36%)
DYNLT2BNP_001338557.1 Tctex-1 44..127 CDD:308957 28/78 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9638
eggNOG 1 0.900 - - E1_KOG4108
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5145
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56346
OrthoDB 1 1.010 - - D1434909at2759
OrthoFinder 1 1.000 - - FOG0006460
OrthoInspector 1 1.000 - - otm41090
orthoMCL 1 0.900 - - OOG6_101459
Panther 1 1.100 - - O PTHR21255
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3738
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.