DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7276 and DYNLT5

DIOPT Version :9

Sequence 1:NP_996092.1 Gene:CG7276 / 39668 FlyBaseID:FBgn0036499 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_689878.2 Gene:DYNLT5 / 200132 HGNCID:26882 Length:179 Species:Homo sapiens


Alignment Length:148 Identity:41/148 - (27%)
Similarity:68/148 - (45%) Gaps:12/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DSRSEVMSHSDSDEEWEPGNEDKPASDVTIY--NYYNMGPAFGKKFPLPYIRLMIAQVVKEKLAN 86
            ||.|.| |:.:     ||...| ..|.:|:.  |.|.:||.  |.||:..:..::..||...|..
Human    40 DSMSTV-SYME-----EPSQRD-DISRLTVQMENTYQLGPP--KHFPVVTVNHILKDVVTSYLQV 95

  Fly    87 KTYNQSEALKWTREVADDINIKMKGRGSSPRFKHVVNVMLYQQTGAGCFYGARAIWDELSDDYIT 151
            :.|......:.|:.:::.|..::|.. ..||:|.:|.|.:.|........|:|.:||..||.:.:
Human    96 EEYEPELCRQMTKTISEVIKAQVKDL-MIPRYKLIVIVHIGQLNRQSILIGSRCLWDPKSDTFSS 159

  Fly   152 FTFDGGSFICIAAVFGCY 169
            :.|...|...:|.|:..|
Human   160 YVFRNSSLFALANVYAVY 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7276NP_996092.1 Tctex-1 72..169 CDD:281624 23/96 (24%)
DYNLT5NP_689878.2 Tctex-1 81..177 CDD:281624 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4108
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6021
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.