DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7276 and dylt-2

DIOPT Version :9

Sequence 1:NP_996092.1 Gene:CG7276 / 39668 FlyBaseID:FBgn0036499 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_509511.1 Gene:dylt-2 / 183892 WormBaseID:WBGene00017014 Length:123 Species:Caenorhabditis elegans


Alignment Length:112 Identity:37/112 - (33%)
Similarity:59/112 - (52%) Gaps:2/112 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 PAFGKKFPLPYIRLMIAQVVKEKLANKT-YNQSEALKWTREVADDINIKMKGRGSSPRFKHVVNV 124
            |..|:||....:..||.:::.|||...| ||..||...:::::..|..::||. ..||:|:|:..
 Worm    13 PTPGQKFRPKAVAGMIQEILGEKLGALTIYNVDEAELVSKDISASIRERLKGL-QLPRYKYVIQT 76

  Fly   125 MLYQQTGAGCFYGARAIWDELSDDYITFTFDGGSFICIAAVFGCYQY 171
            |:.:|.|.|.....:.:|||..|.|:|..:..||..|...||..:.|
 Worm    77 MIAEQCGNGATTAVQCVWDEDCDGYLTQRYVTGSIWCEVLVFAIFHY 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7276NP_996092.1 Tctex-1 72..169 CDD:281624 32/97 (33%)
dylt-2NP_509511.1 Tctex-1 23..121 CDD:281624 32/98 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I7228
eggNOG 1 0.900 - - E1_KOG4108
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I3930
Isobase 1 0.950 - 0 Normalized mean entropy S6688
OMA 1 1.010 - - QHG56346
OrthoDB 1 1.010 - - D1434909at2759
OrthoFinder 1 1.000 - - FOG0006460
OrthoInspector 1 1.000 - - otm14457
orthoMCL 1 0.900 - - OOG6_101459
Panther 1 1.100 - - O PTHR21255
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3738
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.820

Return to query results.
Submit another query.