DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7276 and Dynlt4

DIOPT Version :9

Sequence 1:NP_996092.1 Gene:CG7276 / 39668 FlyBaseID:FBgn0036499 Length:171 Species:Drosophila melanogaster
Sequence 2:XP_008762292.1 Gene:Dynlt4 / 102551208 RGDID:1565942 Length:219 Species:Rattus norvegicus


Alignment Length:113 Identity:31/113 - (27%)
Similarity:57/113 - (50%) Gaps:1/113 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 YNMGPAFGKKFPLPYIRLMIAQVVKEKLANKTYNQSEALKWTREVADDINIKMKGRGSSPRFKHV 121
            |.:.||.|:.:.....:..:...:..:|::..|:.:||.|..:.:.:.|:|::: ..:.||:|.|
  Rat   106 YRIEPAPGEHWEAASAQRALKAALTTQLSDVCYSGTEAGKLVQALCEQIHIRVR-ELNLPRYKLV 169

  Fly   122 VNVMLYQQTGAGCFYGARAIWDELSDDYITFTFDGGSFICIAAVFGCY 169
            .||:|..:.|.|....:||:||...|...:.||...|...:|.|...|
  Rat   170 CNVVLGPREGQGVHVVSRALWDAAHDGLASATFTNPSLFAVATVHAVY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7276NP_996092.1 Tctex-1 72..169 CDD:281624 26/96 (27%)
Dynlt4XP_008762292.1 DLC-like_TCTEX1D4 106..219 CDD:412009 31/113 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10506
eggNOG 1 0.900 - - E1_KOG4108
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45822
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.