DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7276 and dynlt2b

DIOPT Version :9

Sequence 1:NP_996092.1 Gene:CG7276 / 39668 FlyBaseID:FBgn0036499 Length:171 Species:Drosophila melanogaster
Sequence 2:XP_002934090.1 Gene:dynlt2b / 100496772 XenbaseID:XB-GENE-984476 Length:124 Species:Xenopus tropicalis


Alignment Length:117 Identity:40/117 - (34%)
Similarity:62/117 - (52%) Gaps:1/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 NYYNMGPAFGKKFPLPYIRLMIAQVVKEKLANKTYNQSEALKWTREVADDINIKMKGRGSSPRFK 119
            |.|::.|.|..||....::..|..|:||:|::|.|...|..:.||.:::.|..::|..|.. |:|
 Frog     9 NTYSIRPNFQHKFKSAPVKDCIRSVLKEELSDKQYVPEEVPQLTRFLSETIKDRLKDMGFD-RYK 72

  Fly   120 HVVNVMLYQQTGAGCFYGARAIWDELSDDYITFTFDGGSFICIAAVFGCYQY 171
            .||.|::.:|.|.|....||..||..:|:|....|......|:.|.|||:.|
 Frog    73 MVVQVVIGEQRGEGVKMAARCFWDADTDNYAEDVFMNEYLFCVVAAFGCFYY 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7276NP_996092.1 Tctex-1 72..169 CDD:281624 32/96 (33%)
dynlt2bXP_002934090.1 Tctex-1 26..122 CDD:367593 32/96 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9478
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5033
OMA 1 1.010 - - QHG56346
OrthoDB 1 1.010 - - D1434909at2759
OrthoFinder 1 1.000 - - FOG0006460
OrthoInspector 1 1.000 - - mtm9488
Panther 1 1.100 - - O PTHR21255
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.080

Return to query results.
Submit another query.