DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran-like and RAN3

DIOPT Version :9

Sequence 1:NP_524082.1 Gene:Ran-like / 39666 FlyBaseID:FBgn0036497 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_200330.1 Gene:RAN3 / 835612 AraportID:AT5G55190 Length:221 Species:Arabidopsis thaliana


Alignment Length:200 Identity:119/200 - (59%)
Similarity:145/200 - (72%) Gaps:0/200 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWDTAGQERYGGL 75
            |||:::|||||||||.|||||||||:.:|..|:||||..|.|.||.|..|...|||||||::|||
plant    14 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGL 78

  Fly    76 RDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVICGNKVDIMHKKTWKKGVDFDR 140
            ||||::..|||||||||.:..||.||..|||||.|||.|||||:||||||:.:::...|.|.|.|
plant    79 RDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHR 143

  Fly   141 KTNIYLIEMSAKSNYNVEKPFVYLLRKLVGDPSLQLVQSPAIQPPKVVFTDEMSRQVESLFNEAK 205
            |.|:...|:|||||||.||||:||.|||.||.:|..|:|||:.||:|.......:|.|:....|.
plant   144 KKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPALAPPEVQIDLAAQQQHEAELAAAA 208

  Fly   206 SKPLP 210
            |:|||
plant   209 SQPLP 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ran-likeNP_524082.1 PTZ00132 1..210 CDD:240284 117/198 (59%)
Ran 11..176 CDD:206643 105/164 (64%)
RAN3NP_200330.1 PLN03071 1..218 CDD:178620 118/199 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0096
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1083175at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24071
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.