DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran-like and RAN4

DIOPT Version :9

Sequence 1:NP_524082.1 Gene:Ran-like / 39666 FlyBaseID:FBgn0036497 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_200319.1 Gene:RAN4 / 835599 AraportID:AT5G55080 Length:222 Species:Arabidopsis thaliana


Alignment Length:202 Identity:108/202 - (53%)
Similarity:138/202 - (68%) Gaps:11/202 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWDTAGQERYGGL 75
            |||:::|||||||||.:||||||||:.....||||::..|.|.||||..|.:.|||||||:|.||
plant    14 FKLLIVGDGGTGKTTFLKRHLTGEFEHNTEPTLGVDIYPLDFFTNRGKIRFECWDTAGQEKYSGL 78

  Fly    76 RDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVICGNKVDIMHKKTWKKGVDFDR 140
            :|.|::..|||||||||.:.:||.|:.||:|||.|||.|||||:||||||:..::...|.|.:.|
plant    79 KDAYYIHGQCAIIMFDVTARHTYMNIDRWYRDLRRVCKNIPIVLCGNKVDVPSRQIKPKHVSYHR 143

  Fly   141 KTNIYLIEMSAKSNYNVEKPFVYLLRKLVGDPSLQLVQSPAIQPPKVVFTDEMSRQVES---LFN 202
            |..:...|||||:|.|.||||:||.|::.||..|..|:||..|      .|.:  .|||   |..
plant   144 KKCLQYYEMSAKNNCNFEKPFLYLARRIAGDAKLSFVESPEAQ------IDNL--DVESLQLLTV 200

  Fly   203 EAKSKPL 209
            ||.::||
plant   201 EAGTQPL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ran-likeNP_524082.1 PTZ00132 1..210 CDD:240284 108/202 (53%)
Ran 11..176 CDD:206643 95/164 (58%)
RAN4NP_200319.1 PLN03071 1..219 CDD:178620 108/202 (53%)
Ran 14..179 CDD:206643 95/164 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0096
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1083175at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24071
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.