DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran-like and RAN-1

DIOPT Version :9

Sequence 1:NP_524082.1 Gene:Ran-like / 39666 FlyBaseID:FBgn0036497 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_197501.1 Gene:RAN-1 / 832123 AraportID:AT5G20010 Length:221 Species:Arabidopsis thaliana


Alignment Length:202 Identity:118/202 - (58%)
Similarity:147/202 - (72%) Gaps:4/202 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWDTAGQERYGGL 75
            |||:::|||||||||.|||||||||:.:|..|:||||..|.|.||.|..|...|||||||::|||
plant    14 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGL 78

  Fly    76 RDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVICGNKVDIMHKKTWKKGVDFDR 140
            ||||::..|||||||||.:..||.||..|||||.|||.|||||:||||||:.:::...|.|.|.|
plant    79 RDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHR 143

  Fly   141 KTNIYLIEMSAKSNYNVEKPFVYLLRKLVGDPSLQLVQSPAIQPPKV--VFTDEMSRQVESLFNE 203
            |.|:...|:|||||||.||||:||.|||.||.:|..|::||:.||:|  ...|:...:.|.|  :
plant   144 KKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFVETPALAPPEVHIDIADQQKNEAELL--Q 206

  Fly   204 AKSKPLP 210
            |.::|||
plant   207 AAAQPLP 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ran-likeNP_524082.1 PTZ00132 1..210 CDD:240284 116/200 (58%)
Ran 11..176 CDD:206643 105/164 (64%)
RAN-1NP_197501.1 PLN03071 1..218 CDD:178620 118/202 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0096
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1083175at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24071
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.970

Return to query results.
Submit another query.