DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran-like and 1700009N14Rik

DIOPT Version :9

Sequence 1:NP_524082.1 Gene:Ran-like / 39666 FlyBaseID:FBgn0036497 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001074564.1 Gene:1700009N14Rik / 75471 MGIID:1922721 Length:216 Species:Mus musculus


Alignment Length:200 Identity:117/200 - (58%)
Similarity:151/200 - (75%) Gaps:0/200 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWDTAGQERYGGL 75
            |||:|:||||||||..|||||||||:.:|.|||||||..|:|:|:||..:.:||||||||::|||
Mouse    11 FKLVLVGDGGTGKTAFVKRHLTGEFEKKYVATLGVEVHPLMFHTSRGPIKFNVWDTAGQEKFGGL 75

  Fly    76 RDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVICGNKVDIMHKKTWKKGVDFDR 140
            ||||::|:|.|||||||.|..||.||..|||||||||.|||||:||||||:..:|...|.:.|.|
Mouse    76 RDGYYIQAQGAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKDRKVKAKSIVFHR 140

  Fly   141 KTNIYLIEMSAKSNYNVEKPFVYLLRKLVGDPSLQLVQSPAIQPPKVVFTDEMSRQVESLFNEAK 205
            |.|:...::|||||||.||||::|.|:|.||.:|:.|..||:.||:||....::::.|.....|:
Mouse   141 KKNLQYYDISAKSNYNFEKPFLWLSRRLTGDSNLEFVAMPALAPPEVVMDPALAKKYEHDLEVAQ 205

  Fly   206 SKPLP 210
            :..||
Mouse   206 ATALP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ran-likeNP_524082.1 PTZ00132 1..210 CDD:240284 115/198 (58%)
Ran 11..176 CDD:206643 106/164 (65%)
1700009N14RikNP_001074564.1 PTZ00132 1..216 CDD:240284 116/199 (58%)
Ran 11..176 CDD:206643 106/164 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834983
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0096
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.