DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran-like and ran

DIOPT Version :9

Sequence 1:NP_524082.1 Gene:Ran-like / 39666 FlyBaseID:FBgn0036497 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001004829.1 Gene:ran / 448091 XenbaseID:XB-GENE-489468 Length:216 Species:Xenopus tropicalis


Alignment Length:210 Identity:126/210 - (60%)
Similarity:157/210 - (74%) Gaps:0/210 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQPQEEVKAIFKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWD 65
            |..|.|.:..|||:|:|||||||||.|||||||||:.:|.|||||||..|:|:||||..:.:|||
 Frog     1 MAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWD 65

  Fly    66 TAGQERYGGLRDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVICGNKVDIMHKK 130
            |||||::|||||||::|:|||||||||.|..||.||..|||||||||.|||||:|||||||..:|
 Frog    66 TAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRK 130

  Fly   131 TWKKGVDFDRKTNIYLIEMSAKSNYNVEKPFVYLLRKLVGDPSLQLVQSPAIQPPKVVFTDEMSR 195
            ...|.:.|.||.|:...::|||||||.||||::|.|||:|||:.:.|..||:.||:||....::.
 Frog   131 VKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNFEFVAMPALAPPEVVMDPALAA 195

  Fly   196 QVESLFNEAKSKPLP 210
            |.|.....|::..||
 Frog   196 QYEQDLQHAQATALP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ran-likeNP_524082.1 PTZ00132 1..210 CDD:240284 124/208 (60%)
Ran 11..176 CDD:206643 111/164 (68%)
ranNP_001004829.1 PTZ00132 1..216 CDD:240284 126/210 (60%)
Interaction with RANBP1. /evidence=ECO:0000250|UniProtKB:P62826 211..216 126/210 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1083175at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.