DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran-like and RGD1306195

DIOPT Version :9

Sequence 1:NP_524082.1 Gene:Ran-like / 39666 FlyBaseID:FBgn0036497 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001014084.1 Gene:RGD1306195 / 313163 RGDID:1306195 Length:216 Species:Rattus norvegicus


Alignment Length:210 Identity:119/210 - (56%)
Similarity:155/210 - (73%) Gaps:0/210 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQPQEEVKAIFKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWD 65
            |..:.|....|||:|:|||||||||.|||||||||:.:|.|||||||..|:|:|:||..:.:|||
  Rat     1 MAAEGEPPVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLMFHTSRGPIKFNVWD 65

  Fly    66 TAGQERYGGLRDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVICGNKVDIMHKK 130
            |||||::|||||||::|:|.|||||||.|..||.||..|||||||||.|||||:||||||:..:|
  Rat    66 TAGQEKFGGLRDGYYIQAQGAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDVKDRK 130

  Fly   131 TWKKGVDFDRKTNIYLIEMSAKSNYNVEKPFVYLLRKLVGDPSLQLVQSPAIQPPKVVFTDEMSR 195
            ...|.:.|.||.|:...::|||||||.||||::|.|:|.||.:|:.|..||:.||:|:....:::
  Rat   131 VKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLSRRLTGDSNLEFVAMPALAPPEVIMDPALAK 195

  Fly   196 QVESLFNEAKSKPLP 210
            :.|.....|::..||
  Rat   196 KYERDLEVAQTTALP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ran-likeNP_524082.1 PTZ00132 1..210 CDD:240284 117/208 (56%)
Ran 11..176 CDD:206643 107/164 (65%)
RGD1306195NP_001014084.1 PTZ00132 1..216 CDD:240284 119/210 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338573
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0096
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1083175at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24071
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.