DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran-like and Rasl2-9

DIOPT Version :9

Sequence 1:NP_524082.1 Gene:Ran-like / 39666 FlyBaseID:FBgn0036497 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_033054.1 Gene:Rasl2-9 / 19428 MGIID:104605 Length:216 Species:Mus musculus


Alignment Length:210 Identity:122/210 - (58%)
Similarity:156/210 - (74%) Gaps:0/210 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQPQEEVKAIFKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWD 65
            |..|.|.:..||::|:|||||||||.:||||||||:.:|.|||||||..|:|:||||..:.:|||
Mouse     1 MAAQGEPQVQFKVVLVGDGGTGKTTFMKRHLTGEFEKEYVATLGVEVHTLVFHTNRGPIKFNVWD 65

  Fly    66 TAGQERYGGLRDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVICGNKVDIMHKK 130
            |||||::|||||||::|:|||||||||.|..||.||..||:||||||.|||||:||||||:...|
Mouse    66 TAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPSWHKDLVRVCENIPIVLCGNKVDVKDMK 130

  Fly   131 TWKKGVDFDRKTNIYLIEMSAKSNYNVEKPFVYLLRKLVGDPSLQLVQSPAIQPPKVVFTDEMSR 195
            ...|.:.|.||.|:...::||:||||.||||.:|.|||:|||:|:.|..||:.||:||....::.
Mouse   131 VKAKPILFHRKKNLQYYDISARSNYNFEKPFFWLARKLIGDPNLEFVAMPALAPPEVVMDPALAA 195

  Fly   196 QVESLFNEAKSKPLP 210
            |.|.....|::..||
Mouse   196 QYEHDLEVAQTTALP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ran-likeNP_524082.1 PTZ00132 1..210 CDD:240284 120/208 (58%)
Ran 11..176 CDD:206643 107/164 (65%)
Rasl2-9NP_033054.1 Ran 11..176 CDD:206643 107/164 (65%)
RAN 16..215 CDD:128473 116/195 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834985
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0096
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1083175at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.