DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran-like and Ran

DIOPT Version :9

Sequence 1:NP_524082.1 Gene:Ran-like / 39666 FlyBaseID:FBgn0036497 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_033417.1 Gene:Ran / 19384 MGIID:1333112 Length:216 Species:Mus musculus


Alignment Length:210 Identity:127/210 - (60%)
Similarity:158/210 - (75%) Gaps:0/210 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQPQEEVKAIFKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWD 65
            |..|.|.:..|||:|:|||||||||.|||||||||:.:|.|||||||..|:|:||||..:.:|||
Mouse     1 MAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWD 65

  Fly    66 TAGQERYGGLRDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVICGNKVDIMHKK 130
            |||||::|||||||::|:|||||||||.|..||.||..|||||||||.|||||:|||||||..:|
Mouse    66 TAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRK 130

  Fly   131 TWKKGVDFDRKTNIYLIEMSAKSNYNVEKPFVYLLRKLVGDPSLQLVQSPAIQPPKVVFTDEMSR 195
            ...|.:.|.||.|:...::|||||||.||||::|.|||:|||:|:.|..||:.||:||....::.
Mouse   131 VKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAA 195

  Fly   196 QVESLFNEAKSKPLP 210
            |.|.....|::..||
Mouse   196 QYEHDLEVAQTTALP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ran-likeNP_524082.1 PTZ00132 1..210 CDD:240284 125/208 (60%)
Ran 11..176 CDD:206643 112/164 (68%)
RanNP_033417.1 RAN 16..215 CDD:128473 120/195 (62%)
Interaction with RANBP1. /evidence=ECO:0000250|UniProtKB:P62826 211..216 127/210 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834984
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0096
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S18
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1083175at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.760

Return to query results.
Submit another query.