DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran-like and F11A5.4

DIOPT Version :9

Sequence 1:NP_524082.1 Gene:Ran-like / 39666 FlyBaseID:FBgn0036497 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_507084.1 Gene:F11A5.4 / 184331 WormBaseID:WBGene00008672 Length:203 Species:Caenorhabditis elegans


Alignment Length:166 Identity:56/166 - (33%)
Similarity:94/166 - (56%) Gaps:7/166 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IFKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWDTAGQERYGG 74
            :||.::|||.|.||:.|:.|.:...|...:.:|||:|........:|...::.||||.||||:..
 Worm     6 VFKYVIIGDRGVGKSNLLLRFIGKPFDSIHPSTLGIEFGFRNLEIDRKKVKLHVWDTCGQERFRS 70

  Fly    75 LRDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCG-NIPIVICGNKVDIMHKKTWKK--GV 136
            |...|:..:..|::::|:.|..::.:::.|..||.|:.. :|.||:.|||.|:...:..:|  |.
 Worm    71 LVGSYYRHAIGALLVYDITSRESFYHLEHWLTDLQRLGDPDIVIVLIGNKSDLEADREVRKEEGE 135

  Fly   137 DFDRKTNIYLIEMSAKSNYNVEKPFV----YLLRKL 168
            .|.|:..:..:|:|||:|..||:.||    .:.|||
 Worm   136 AFAREFGLIFMEISAKTNEYVEEAFVNSAHEIYRKL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ran-likeNP_524082.1 PTZ00132 1..210 CDD:240284 56/166 (34%)
Ran 11..176 CDD:206643 56/165 (34%)
F11A5.4NP_507084.1 RAB 7..170 CDD:197555 53/162 (33%)
Rab 7..164 CDD:206640 53/156 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S18
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.