DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and EIF3G

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_003746.2 Gene:EIF3G / 8666 HGNCID:3274 Length:320 Species:Homo sapiens


Alignment Length:134 Identity:34/134 - (25%)
Similarity:52/134 - (38%) Gaps:26/134 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LSTLQAQFPESSGLQYRNV-----DTKAVRGVRSNEGRLYSPSEETGWGEYHYFCVFPKKNKRQS 86
            |..:|.:..|..||.....     :.:.|:..::..|:...||...|             ..|:.
Human   175 LGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDG-------------ASRRG 226

  Fly    87 EDNLENSTAKTKRTEAHLRCFDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFG 151
            |....|..|....|        :.|..||.:|.|.||:|.|..:|.:.:..:.||..:|.||||.
Human   227 ESMQPNRRADDNAT--------IRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFA 283

  Fly   152 FVRF 155
            |:.|
Human   284 FISF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833 10/55 (18%)
RRM1_TDP43 108..181 CDD:409760 19/48 (40%)
RRM2_TDP43 193..262 CDD:409761
EIF3GNP_003746.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59
eIF3G 62..173 CDD:240597
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..234 7/37 (19%)
RRM_eIF3G_like 240..315 CDD:409842 20/56 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.