DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and HRP1

DIOPT Version :9

Sequence 1:NP_001261874.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_014518.1 Gene:HRP1 / 853997 SGDID:S000005483 Length:534 Species:Saccharomyces cerevisiae


Alignment Length:315 Identity:88/315 - (27%)
Similarity:142/315 - (45%) Gaps:35/315 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AEEDGTLLLSTLQAQFPESSGLQYRNVDTKAVRGVRSNEGRLYSPSEETG--WGEYHYFCVFPKK 81
            :::|||       |...|.|....:| :.|......:|.....|.:..:|  |.:........::
Yeast    75 SKQDGT-------ANDKEGSNEDTKN-EKKQESATSANANANASSAGPSGLPWEQLQQTMSQFQQ 131

  Fly    82 NKRQSEDNLENSTAKTKRTEAHL---RCFDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTR 143
            ...||....:.:..|.:|::|.|   .| .:.:.||:::|||.:|||||..||.|...:|.||..
Yeast   132 PSSQSPPQQQVTQTKEERSKADLSKESC-KMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPA 195

  Fly   144 SGHSKGFGFVRFGSYDVQMHVLSKRHSIDGRWCEVK--VPASRGMGNQEPGKVFVGRCTEDIEAD 206
            :|.|:||||:.|........|:..:|.:||:..:.|  :|...   ..:.||:|||....|:...
Yeast   196 TGRSRGFGFLSFEKPSSVDEVVKTQHILDGKVIDPKRAIPRDE---QDKTGKIFVGGIGPDVRPK 257

  Fly   207 DLREYFSKFGEVID--VFIPK---PFRAFSFVTFLDPYVPRVVCGEKHI-IKGVSVHVSTADKKN 265
            :..|:||::|.:||  :.:.|   ..|.|.|||:........||..|.| .|...:.:..|:.::
Yeast   258 EFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKFIDFKDRKIEIKRAEPRH 322

  Fly   266 VQNKNQLFQTNNYNNLDNNFKMQPANNFRMHPANNFSMHSFNP--HGYQMNRVMN 318
            :|.|:   ..|..||..||...:..|   .....:|:....||  .||  |.:||
Yeast   323 MQQKS---SNNGGNNGGNNMNRRGGN---FGNQGDFNQMYQNPMMGGY--NPMMN 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_001261874.1 RRM1_TDP43 108..184 CDD:240767 29/77 (38%)
RRM2_TDP43 193..262 CDD:240768 22/74 (30%)
HRP1NP_014518.1 PABP-1234 <144..463 CDD:130689 74/238 (31%)
RRM1_Hrp1p 161..236 CDD:409991 28/74 (38%)
RRM2_Hrp1p 244..321 CDD:409767 23/76 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.