DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and YRA1

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_010669.1 Gene:YRA1 / 851988 SGDID:S000002789 Length:226 Species:Saccharomyces cerevisiae


Alignment Length:180 Identity:30/180 - (16%)
Similarity:60/180 - (33%) Gaps:54/180 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KKNKRQSEDNLENSTAKTKRTEAHLRCFDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRS 144
            :||.|..    .|:.|:..:.....|...:.|.||..:..:..:||:|.:....|:..:......
Yeast    55 RKNTRAP----PNAVARVAKLLDTTREVKVNVEGLPRDIKQDAVREFFASQVGGVQRVLLSYNER 115

  Fly   145 GHSKGFGFVRFGSYDVQMHVLSKRHS--IDGRWCEVKV--------------------------- 180
            |.|.|...:.|.:.::....:.:.:.  |||....:::                           
Yeast   116 GQSTGMANITFKNGELARRAVERFNGSPIDGGRSRLRLNLIVDPNQRPVKSLADRIKAMPQKGGN 180

  Fly   181 ---PASRGMG-------------NQEPGKVFVGRCTEDIEADDLREYFSK 214
               |..||..             .::|.|    :..||:: .::.:||.|
Yeast   181 APRPVKRGPNRKAAMAKSQNKPKREKPAK----KSLEDLD-KEMADYFEK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 14/104 (13%)
RRM2_TDP43 193..262 CDD:409761 6/22 (27%)
YRA1NP_010669.1 RRM_YRA1_MLO3 78..156 CDD:409711 14/77 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.