DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and AT5G59860

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_200794.1 Gene:AT5G59860 / 836108 AraportID:AT5G59860 Length:157 Species:Arabidopsis thaliana


Alignment Length:169 Identity:40/169 - (23%)
Similarity:71/169 - (42%) Gaps:20/169 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LQAQFPESSGLQYRNVDTKAVRGVRSNEGRLYSPSEETGWGEYHYFCVFPKKNKRQSEDNLENST 94
            ::|...:.:|::...|:.....|     .|.:.|.:.:|..:..  ..|.|:.|.:......:|.
plant     1 MKADPRKETGIKLVAVEISLTFG-----NRKWQPHKNSGAKDEE--AKFNKRTKYKMRIRPRSSI 58

  Fly    95 AKTKRTEAHLRCFDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYD 159
            :|.:|.........:...|||..||:|.||:.|..:     |.:.||.::...|||||:.|.|.|
plant    59 SKRRRLIGGKTLTCVSNSGLSAYTTDQSLRQLFAPF-----ARLIKDQQTQRPKGFGFITFESED 118

  Fly   160 VQMHVLSKRHS--IDGRWC------EVKVPASRGMGNQE 190
            .....|...:.  ::||..      ||:.|.:....|::
plant   119 DAQKALKALNGKIVNGRLIFVETAKEVEAPTTSLKSNKD 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833 7/47 (15%)
RRM1_TDP43 108..181 CDD:409760 25/80 (31%)
RRM2_TDP43 193..262 CDD:409761
AT5G59860NP_200794.1 RRM 73..144 CDD:440488 23/75 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.