DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and AT5G53680

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_200179.1 Gene:AT5G53680 / 835449 AraportID:AT5G53680 Length:169 Species:Arabidopsis thaliana


Alignment Length:95 Identity:23/95 - (24%)
Similarity:46/95 - (48%) Gaps:8/95 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 HLRCFD-----LIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYDVQM 162
            |.:.||     :.|.||.:.|.::.|..:|:.:|:::...:..|..:..|:|:|||.|...:...
plant     4 HHQNFDTTFTKIYVGGLPWTTRKEGLINFFKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAESAT 68

  Fly   163 HVLSKRH-SIDGRW--CEVKVPASRGMGNQ 189
            ......: :|:||.  |::....::...||
plant    69 RACKDPNPTIEGRITNCKLAFVGAKVKPNQ 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 19/80 (24%)
RRM2_TDP43 193..262 CDD:409761
AT5G53680NP_200179.1 RRM_SF 13..88 CDD:473069 18/74 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.