DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and AT5G40490

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_198865.1 Gene:AT5G40490 / 834047 AraportID:AT5G40490 Length:423 Species:Arabidopsis thaliana


Alignment Length:166 Identity:49/166 - (29%)
Similarity:84/166 - (50%) Gaps:10/166 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYDVQMHVLSKRHSIDG 173
            :.|.||:..||..:..::|..||::..:.|.||.::|..:|||||.:....|...|:...|.|.|
plant    44 IFVGGLARETTSAEFLKHFGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKVIQDNHIIIG 108

  Fly   174 RWCEVKVPASRG-MGNQE--PGKVFVGRCTEDIEADDLREYFSKFGEVIDVFIPKPF-----RAF 230
            :..|:|....|| |.:.:  ..|:|||.....::.|:.:|:|.:|||:.:..|.:..     |.|
plant   109 KQVEIKRTIPRGSMSSNDFKTKKIFVGGIPSSVDDDEFKEFFMQFGELKEHQIMRDHSTGRSRGF 173

  Fly   231 SFVTF-LDPYVPRVVC-GEKHIIKGVSVHVSTADKK 264
            .|||: .:..|..::. |.:..:.|..|.:..|:.|
plant   174 GFVTYESEDMVDHLLAKGNRIELSGTQVEIKKAEPK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 24/71 (34%)
RRM2_TDP43 193..262 CDD:409761 20/75 (27%)
AT5G40490NP_198865.1 RRM_SF 44..114 CDD:473069 23/69 (33%)
RRM_SF 131..209 CDD:473069 21/77 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.