DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cocoon and AT5G04600

DIOPT Version :10

Sequence 1:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_196080.1 Gene:AT5G04600 / 830337 AraportID:AT5G04600 Length:222 Species:Arabidopsis thaliana


Alignment Length:136 Identity:28/136 - (20%)
Similarity:56/136 - (41%) Gaps:26/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 VFVGRCTEDIEADDLREYFSKFGEVIDVFIPK-----PFRAFSFVTFLDPYVPRVVCGE------ 247
            :::||........::..:||:||.|..|.:.:     ..:.|.|:.|.||.|..:..|.      
plant    62 LYIGRIPHGFYETEIEAFFSQFGTVKRVRVARNKKTGKSKHFGFIQFEDPEVAEIAAGAMNDYLL 126

  Fly   248 -KHIIKGVSVHVSTADKKNVQNKNQLFQTNNYNNLDNNFKMQPANNFRMHPANNFSMHSFNPHGY 311
             :|::|   |||  .:.:||       :.|.:.....|||  |.::.::.........:...|..
plant   127 MEHMLK---VHV--IEPENV-------KPNLWRGFKCNFK--PVDSVQIERRQLNKERTLEEHRK 177

  Fly   312 QMNRVM 317
            .:.:::
plant   178 MLQKIV 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760
RRM2_TDP43 193..262 CDD:409761 20/79 (25%)
AT5G04600NP_196080.1 RRM_NIFK_like 61..134 CDD:409748 17/74 (23%)
PABP-1234 80..>204 CDD:130689 26/118 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.